PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A05G3515
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 284aa    MW: 32397.5 Da    PI: 8.132
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A05G3515genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding591e-18125172148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+WT eEd +l+++++ +G ++W+tIa++ g++R++k+c++rw +yl
      Gh_A05G3515 125 KGAWTSEEDTKLAEVIAVHGAKSWNTIASKAGLKRCGKSCRLRWMNYL 172
                      79********************************************97 PP

2Myb_DNA-binding51.13.1e-16178223148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+ +++E++l+++++k+lG++ W++Ia +++ gRt++++k++w+++l
      Gh_A05G3515 178 RGNISEQEEDLILRLHKLLGNR-WSLIAGRLP-GRTDNEIKNYWNSHL 223
                      7899******************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.735120172IPR017930Myb domain
SuperFamilySSF466895.5E-29123219IPR009057Homeodomain-like
SMARTSM007172.1E-14124174IPR001005SANT/Myb domain
PfamPF002492.7E-17125172IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.2E-24126179IPR009057Homeodomain-like
CDDcd001671.32E-9127172No hitNo description
PROSITE profilePS5129426.066173227IPR017930Myb domain
SMARTSM007177.1E-16177225IPR001005SANT/Myb domain
PfamPF002498.6E-15178223IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.2E-25180228IPR009057Homeodomain-like
CDDcd001674.57E-10182223No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 284 aa     Download sequence    Send to blast
MEKTVGVGAS TSSMWTRPTI ANVRLVVEIF DGTGHFGMWQ SEVLDALFQQ GLDIAIDEEK  60
PDDVQEKDWK AINRLACGTI RSCLSREQSS SNHYRLSNHT NPILETIIGV KKERPASSKR  120
SQINKGAWTS EEDTKLAEVI AVHGAKSWNT IASKAGLKRC GKSCRLRWMN YLRPNIKRGN  180
ISEQEEDLIL RLHKLLGNRW SLIAGRLPGR TDNEIKNYWN SHLSKKIKQK EKQGCKDEKR  240
LVENGKEELR EENTCAAGGE DSNISFDVDE FFDFSDEKFE WINR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A9e-291252277108B-MYB
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.80871e-126boll
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY6323601e-137AY632360.1 Gossypium hirsutum BAC 106I22, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012461068.11e-123PREDICTED: transcription factor MYB114-like
TrEMBLA0A0D2V0911e-136A0A0D2V091_G
STRINGPOPTR_0003s06320.13e-75(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G14750.11e-52myb domain protein 66